1. Peptides
  2. α-Hemolysin (Staphylococcus aureus)

α-Hemolysin (Staphylococcus aureus) 

Cat. No.: HY-P2967
Handling Instructions

α-Hemolysin (Staphylococcus aureus) is one of the most characteristic virulence factors secreted by Staphylococcus aureus, a polypeptide capable of destroying the host cell plasma membrane. After α-Hemolysin binds to the cell surface, its monomers assemble into a homoheptamer to form a front pore, which then transforms into a mature transmembrane pore water channel, allowing K+ and Ca2+ ion transport, leading to necrotic death of target cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

α-Hemolysin (Staphylococcus aureus) Chemical Structure

α-Hemolysin (Staphylococcus aureus) Chemical Structure

CAS No. : 94716-94-6

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

α-Hemolysin (Staphylococcus aureus) is one of the most characteristic virulence factors secreted by Staphylococcus aureus, a polypeptide capable of destroying the host cell plasma membrane. After α-Hemolysin binds to the cell surface, its monomers assemble into a homoheptamer to form a front pore, which then transforms into a mature transmembrane pore water channel, allowing K+ and Ca2+ ion transport, leading to necrotic death of target cells[1].

In Vitro

α-Hemolysin (Staphylococcus aureus) induces IL-1β secretion and caspase-1 activation in THP-1 cells, and induces IL-1β secretion through activation of NLRP3-inflammasome-dependent caspase-1[1].
α-Hemolysin (Staphylococcus aureus) (1 µg/mL, 4h) induces THP-derived cell death requiring host NLRP3 signaling but independent of caspase-1 activation and IL-1β secretion[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

28569.06

Formula

C1269H1971N339O400S6

CAS No.
Sequence

Ala-Asp-Ser-Asp-Ile-Asn-Ile-Lys-Thr-Gly-Thr-Thr-Asp-Ile-Gly-Ser-Asn-Thr-Thr-Val-Lys-Thr-Gly-Asp-Leu-Val-Thr-Tyr-Asp-Lys-Glu-Asn-Gly-Met-His-Lys-Lys-Val-Phe-Tyr-Ser-Phe-Ile-Asp-Asp-Lys-Asn-Ala-Ile-Lys-Lys-Leu-Leu-Val-Ile-Arg-Thr-Lys-Gly-Thr-Ile-Ala-Gly-Gln-Tyr-Arg-Val-Tyr-Ser-Glu-Glu-Gly-Ala-Asn-Lys-Ser-Gly-Leu-Ala-Trp-Pro-Ser-Ala-Phe-Lys-Val-Gln-Leu-Gln-Leu-Pro-Asp-Asn-Glu-Val-Ala-Glu-Ile-Ser-Asp-Tyr-Tyr-Pro-Arg-Asn-Ser-Ile-Asp-Thr-Lys-Glu-Tyr-Met-Ser-Thr-Leu-Thr-Tyr-Gly-Phe-Asn-Gly-Asn-Val-Thr-Gly-Asp-Asp-Thr-Gly-Lys-Ile-Gly-Gly-Leu-Ile-Gly-Ala-Asn-Val-Ser-Ile-Gly-His-Thr-Leu-Lys-Tyr-Val-Gln-Pro-Asp-Phe-Lys-Thr-Ile-Leu-Glu-Ser-Pro-Thr-Asp-Lys-Lys-Val-Gly-Trp-Lys-Val-Ile-Phe-Asn-Asn-Met-Val-Asn-Gln-Asn-Trp-Gly-Pro-Tyr-Asp-Arg-Asp-Ser-Trp-Asn-Pro-Val-Tyr-Gly-Asn-Gln-Leu-Phe-Met-Lys-Thr-Arg-Asn-Gly-Ser-Met-Lys-Ala-Ala-Asp-Asn-Phe-Leu-Asp-Pro-Asn-Lys-Ala-Ser-Ser-Leu-Leu-Ser-Ser-Gly-Phe-Ser-Pro-Asp-Phe-Ala-Thr-Val-Ile-Thr-Met-Asp-Arg-Lys-Ala-Ser-Lys-Gln-Gln-Thr-Asn-Ile-Asp-Val-Ile-Tyr-Glu-Arg-Val-Arg-Asp-Asp-Tyr-Gln-Leu-His-Trp-Thr-Ser-Thr-Asn-Trp-Lys-Gly-Thr-Asn-Thr-Lys-Asp-Lys-Trp-Thr-Asp-Arg-Ser-Ser-Glu-Arg-Tyr-Lys-Ile-Asp-Trp-Glu-Lys-Glu-Glu-Met-Thr-Asn

Sequence Shortening

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNAIKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAEISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
α-Hemolysin (Staphylococcus aureus)
Cat. No.:
HY-P2967
Quantity:
MCE Japan Authorized Agent: