2. GPCR/G Protein Neuronal Signaling
  3. Melanocortin Receptor
  4. Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)  (Synonyms: 1-39-Corticotropin (human)(TFA))

Cat. No.: HY-P1211A Purity: 98.64%
COA Handling Instructions

Molarity Calculator

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Chemical Structure

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Chemical Structure

Size Price Stock Quantity
500 μg USD 140 In-stock
1 mg USD 240 In-stock
5 mg USD 500 In-stock
10 mg USD 720 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA):

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.

IC50 & Target

Melanocortin receptor[1]
In Vitro

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH 1-39), a member of the melanocortin family, stimulates production of CS by the adrenals, but melanocortin receptors are also found in the central nervous system (CNS) and on immune cells. ACTH 1-39 protects neurons in vitro from several apoptotic, excitotoxic and inflammation-related insults[1]. The conditioned medium (CM) is prepared from untreated astroglia (AS) cultures and from AS cultures treated with 200 nM ACTH 1-39 for 24 h, washed to remove ACTH 1-39, then incubated for another 24 h in DMEM. In initial experiments, no difference is found in oligodendroglia (OL) viability in the presence of OL definedmediumwith 2% newborn calf serum (NCS) or AS CM (prepared in DMEM with no serum). After 24 h, OL death under each condition varies between 1 and 4%. Similar results for OL viability are obtained with microglia (MG) CM. In subsequent experiments, controls in each experiment consist of OL in defined medium with 2% NCS[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Related Antibodies
Molecular Weight

4541.14 (free base)

Formula

C207H308N56O58S.xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Sequence Shortening

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Purity & Documentation
References
Cell Assay
[2]

For analysis of the effects of ACTH 1-39 or CM on oligodendroglia (OL) death, purified OL cultures are incubated with ACTH 1-39 at 200 nM or the various CM for 30 min before addition of the toxic agents. Cell death is assessed after 1 day using trypan blue uptake as the indicator of cell death. Trypan blue is considered a preferred method for measurement of total cell death compared to terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL), which measures only apoptosis, or live/dead fluorescent assays, which may not detect permeable dead cells with degraded DNA, thus underestimating cell death. Differentiated OL are identified by their characteristicmorphology, that is, rounded or oval birefringent cells with multiple lacy branching processes, and in some cases by immunostaining with antibodies to galactolipids[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)1-39-Corticotropin (human)(TFA)Melanocortin ReceptorMC ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)
Cat. No.:
HY-P1211A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.