Peptide YY (PYY) (3-36), porcine

Cat. No.: HY-P1021: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

For research use only. We do not sell to patients.

Peptide YY (PYY) (3-36), porcine Chemical Structure

CAS No. : 126339-09-1

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Peptide YY (PYY) (3-36), porcine:

Other Forms of Peptide YY (PYY) (3-36), porcine:

Peptide YY (PYY) (3-36), porcine TFA In-stock

3 Publications Citing Use of MCE Peptide YY (PYY) (3-36), porcine

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

IC₅₀ & Target

Y2 receptor^[1]

In Vitro

Peptide YY (PYY) (3-36), porcine is a Y2 receptor agonist, generated via cleaving the first two amino acids at the N terminus of PYY1-36 by enzyme dipeptidyl peptidase-IV (DPP-IV), and can reduces food intake^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In mice, actinonin significantly prolongs the anorectic effect of PYY_3-36 (50 nmol/kg) and maintains higher PYY_3-36 plasma levels than treatment with PYY_3-36 alone^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3980.42

Formula

C₁₇₆H₂₇₂N₅₂O₅₄

CAS No.

126339-09-1

Sequence

Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility

In Vitro:

H₂O

Peptide Solubility and Storage Guidelines:

1. Calculate the length of the peptide.

2. Calculate the overall charge of the entire peptide according to the following table:

	Contents	Assign value
Acidic amino acid	Asp (D), Glu (E), and the C-terminal -COOH.	-1
Basic amino acid	Arg (R), Lys (K), His (H), and the N-terminal -NH₂	+1
Neutral amino acid	Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q)	0

3. Recommended solution:

Overall charge of peptide	Details
Negative (<0)	1. Try to dissolve the peptide in water first. 2. If water fails, add NH₄OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0)	1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0)	1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Addison ML, et al. A role for metalloendopeptidases in the breakdown of the gut hormone, PYY 3-36. Endocrinology. 2011 Dec;152(12):4630-40. [Content Brief]

Animal Administration
^[1]

Mice^[1]
Mice are divided into four treatment groups and administered an injection (maximum volume, 100 μL, sc) of either: 1) saline (n = 10), 2) phosphoramidon (10 mg/kg) (n = 10), 3) PYY_3-36 (50 nmol/kg) (n = 10), or 4) PYY_3-36 (50 nmol/kg) and phosphoramidon (10 mg/kg) (n = 10). This dose of phosphoramidon inhibits NEP activity for 4 h. Body weight is measured at 0 and 24 h after injection. Food intake is measured at 1, 2, 3, 4, 8, and 24 h after injection^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

[1]. Addison ML, et al. A role for metalloendopeptidases in the breakdown of the gut hormone, PYY 3-36. Endocrinology. 2011 Dec;152(12):4630-40. [Content Brief]