1. Peptides

Peptide YY (PYY) (3-36), human (Synonyms: Peptide YY (3-36))

Cat. No.: HY-P1021
Handling Instructions

Peptide YY (PYY) (3-36), human is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. Sequence: Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY) (3-36), human Chemical Structure

Peptide YY (PYY) (3-36), human Chemical Structure

CAS No. : 126339-09-1

Size Price Stock
1 mg USD 110 Get quote
5 mg USD 330 Get quote
10 mg USD 530 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


Peptide YY (PYY) (3-36), human is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. Sequence: Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.

IC50 & Target

Y2 receptor[1]

In Vitro

Peptide YY (PYY) (3-36), human is a Y2 receptor agonist, generated via cleaving the first two amino acids at the N terminus of PYY1-36 by enzyme dipeptidyl peptidase-IV (DPP-IV), and can reduces food intake[1].

In Vivo

In mice, actinonin significantly prolongs the anorectic effect of PYY3-36 (50 nmol/kg) and maintains higher PYY3-36 plasma levels than treatment with PYY3-36 alone[1].

Solvent & Solubility
In Vitro: 


Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Animal Administration

Mice are divided into four treatment groups and administered an injection (maximum volume, 100 μL, sc) of either: 1) saline (n = 10), 2) phosphoramidon (10 mg/kg) (n = 10), 3) PYY3-36 (50 nmol/kg) (n = 10), or 4) PYY3-36 (50 nmol/kg) and phosphoramidon (10 mg/kg) (n = 10). This dose of phosphoramidon inhibits NEP activity for 4 h. Body weight is measured at 0 and 24 h after injection. Food intake is measured at 1, 2, 3, 4, 8, and 24 h after injection[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight







Please store the product under the recommended conditions in the Certificate of Analysis.


Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (PYY) (3-36), human
Cat. No.:

Peptide YY (PYY) (3-36), human

Cat. No.: HY-P1021