1. GPCR/G Protein
  2. Glucagon Receptor

Glucagon Receptor

Glucagon receptor is in the G protein-coupled receptor family, that is important in controlling blood glucose levels. The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to G alpha i, Gs and to a lesser extent G alpha q. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney with lesser amounts found in heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

Glucagon Receptor Related Products (28):

Cat. No. Product Name Effect Purity
  • HY-13443
    Exendin-4 Activator 98.96%
    Exendin-4, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
  • HY-P0082
    Glucagon
    Glucagon is a peptide hormone, exhibits therapeutic potential for metabolic disease.
  • HY-P0014
    Liraglutide Agonist 99.96%
    Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus.
  • HY-50663
    MK 0893 Antagonist 99.22%
    MK 0893 is a potent, selective glucagon receptor antagonist with IC50 of 6.6 nM, and > 200 fold selectivity against GIPR, PAC1, GLP-1R, VPAC1 and VPAC2.
  • HY-19904
    Adomeglivant Antagonist 99.55%
    Adomeglivant is a potent and selective glucagon receptor antagonist that is used in clinical trial for type 2 diabetes mellitus.
  • HY-103546
    BETP Agonist 99.28%
    BETP is an agonist of glucagon-like peptide-1 (GLP-1) receptor, with EC50s of 0.66 and 0.755 μM for human and rat GLP-1 receptor, respectively.
  • HY-P1458
    Glucagon-Like Peptide (GLP) I (7-36), amide, human
    Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion.
  • HY-P0264
    Exendin 9-39 Antagonist
    Exendin (9-39) is a specific and competitive glucagon-like peptide-1 receptor antagonist.
  • HY-P0054
    GLP-1(7-36) Acetate 98.42%
    GLP-1(7-36) is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
  • HY-13443A
    Exendin-4 Acetate Activator 98.69%
    Exendin-4 acetate, a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
  • HY-P0119
    Lixisenatide Inhibitor 98.36%
    Lixisenatide inhibit glucagon release, markedly reduce postprandial glucago.
  • HY-P0055
    GLP-1(7-37) Inhibitor 98.62%
    GLP-1(7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1(1-37).
  • HY-12525
    LGD-6972 Antagonist >98.0%
    LGD-6972 is a glucagon receptor antagonist.
  • HY-19947
    Glucagon receptor antagonists-4 Antagonist
    Glucagon receptor antagonists-4 is a highly potent glucagon receptor antagonist. It displays low in vivo clearance and excellent oral bioavailability in both rats and dogs.
  • HY-10036
    Glucagon receptor antagonists-1 Antagonist
    Glucagon receptor antagonists-1 is a highly potent glucagon receptor antagonist.
  • HY-50158
    Glucagon receptor antagonists-2 Antagonist
    Glucagon receptor antagonists-2 is a highly potent glucagon receptor antagonist.
  • HY-P0165
    Taspoglutide Agonist
    Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist developed for treatment of type 2 diabetes, with an EC50 value of 0.06 nM.
  • HY-50159
    Glucagon receptor antagonists-3 Antagonist
    Glucagon receptor antagonists-3 is a highly potent glucagon receptor antagonist.
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-P1226
    HAEGTFTSD Agonist 98.04%
    HAEGTFTSD is the first N-terminal 1-9 residues of GLP-1 peptide.
Isoform Specific Products

Your Search Returned No Results.

Sorry. There is currently no product that acts on isoform together.

Please try each isoform separately.