1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid 1-40

β-Amyloid 1-40 

Cat. No.: HY-P0265 Purity: 95.09%
Handling Instructions

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid 1-40 Chemical Structure

β-Amyloid 1-40 Chemical Structure

CAS No. : 131438-79-4

Size Price Stock Quantity
500 μg USD 96 In-stock
Estimated Time of Arrival: December 31
1 mg USD 144 In-stock
Estimated Time of Arrival: December 31
5 mg USD 468 In-stock
Estimated Time of Arrival: December 31
10 mg USD 792 In-stock
Estimated Time of Arrival: December 31
25 mg USD 1068 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

In Vitro

β-Amyloid (1-40) and (1-42) are major components of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma. The levels of CSF β-Amyloid (1-40) and (1-42) show a U-shaped natural course in normal aging[1].Chronic infusion of beta-amyloid (1-40) for 14 days into the rat cerebroventricle decreased the activity of soluble protein kinase C (PKC) in the hippocampus. Subcellular translocation of PKC to membrane fraction in hippocampal slices of rats treated with beta-amyloid (1-40) is completely abolished under acute stimulation with 0.5 microM phorbol-dibutyrate (PDBu)[2].

In Vivo

Chronic infusion of β-Amyloid (1-40) into rat cerebroventricle leads to deficit in spatial and non-spatial memory formation[2]. Chronic treatment of β-Amyloid (1-40) does not change lever-pressing performance significantly, but performance declined significantly 30 days after termination of the chronic daily regimen. The soluble unaggregated form of β-Amyloid (1-40), injected into the dorsal hippocampus, does not appear to have behavioral effects on performance or short-term working memory in rats, but multiple repeat injections produced performance decrements several weeks later. Repeated injection of β-Amyloid (1-40) through indwelling cannulae shows promise for development of an animal model of Alzheimer's disease[3].

Molecular Weight

4329.82

Formula

C₁₉₄H₂₉₅N₅₃O₅₈S

CAS No.

131438-79-4

Sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
Animal Administration
[3]

Rats: HPLC buffer insures the β-Amyloid (1-40) does not aggregate in solution prior to injection, β-Amyloid (1-40) and vehicle are bilaterally infused into the hippocampus, 20 min before experimental sessions, in volumes of 1, 2 and 3 μL per side, at a rate of <1 μL/min. Different volumes of the 1 μM solution are used. Volumes (doses) are given in random order and at least three sham-injection sessions are interposed between β-Amyloid (1-40) or vehicle injections. All rats receive all doses of β-Amyloid (1-40) under the acute injection regimen[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid 1-40
Cat. No.:
HY-P0265
Quantity: