1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid (1-40)

β-Amyloid (1-40) 

Cat. No.: HY-P0265 Purity: 95.94%
Handling Instructions

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40) Chemical Structure

β-Amyloid (1-40) Chemical Structure

CAS No. : 131438-79-4

Size Price Stock Quantity
500 μg USD 96 In-stock
Estimated Time of Arrival: December 31
1 mg USD 144 In-stock
Estimated Time of Arrival: December 31
5 mg USD 468 In-stock
Estimated Time of Arrival: December 31
10 mg USD 792 In-stock
Estimated Time of Arrival: December 31
25 mg USD 1068 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-40):

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

In Vitro

β-Amyloid (1-40) and (1-42) are major components of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma. The levels of CSF β-Amyloid (1-40) and (1-42) show a U-shaped natural course in normal aging[1].Chronic infusion of beta-amyloid (1-40) for 14 days into the rat cerebroventricle decreased the activity of soluble protein kinase C (PKC) in the hippocampus. Subcellular translocation of PKC to membrane fraction in hippocampal slices of rats treated with beta-amyloid (1-40) is completely abolished under acute stimulation with 0.5 microM phorbol-dibutyrate (PDBu)[2].
The further aggregation of β-Amyloid (1-40)
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80°C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was age 48h at 4-8°C. The sample was then centrifuged at 14000g for 10 min at 4-8°C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Chronic infusion of β-Amyloid (1-40) into rat cerebroventricle leads to deficit in spatial and non-spatial memory formation[2]. Chronic treatment of β-Amyloid (1-40) does not change lever-pressing performance significantly, but performance declined significantly 30 days after termination of the chronic daily regimen. The soluble unaggregated form of β-Amyloid (1-40), injected into the dorsal hippocampus, does not appear to have behavioral effects on performance or short-term working memory in rats, but multiple repeat injections produced performance decrements several weeks later. Repeated injection of β-Amyloid (1-40) through indwelling cannulae shows promise for development of an animal model of Alzheimer's disease[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4329.82

Formula

C₁₉₄H₂₉₅N₅₃O₅₈S

CAS No.
Sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
-20°C 1 year
In solvent -80°C 6 months
-20°C 1 month
Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (23.10 mM; Need ultrasonic)

H2O : < 0.1 mg/mL (insoluble)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2310 mL 1.1548 mL 2.3096 mL
5 mM 0.0462 mL 0.2310 mL 0.4619 mL
10 mM 0.0231 mL 0.1155 mL 0.2310 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Animal Administration
[3]

Rats: HPLC buffer insures the β-Amyloid (1-40) does not aggregate in solution prior to injection, β-Amyloid (1-40) and vehicle are bilaterally infused into the hippocampus, 20 min before experimental sessions, in volumes of 1, 2 and 3 μL per side, at a rate of <1 μL/min. Different volumes of the 1 μM solution are used. Volumes (doses) are given in random order and at least three sham-injection sessions are interposed between β-Amyloid (1-40) or vehicle injections. All rats receive all doses of β-Amyloid (1-40) under the acute injection regimen[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Purity: 95.94%

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

β-Amyloid (1-40)Amyloid-ββ-amyloid peptideAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-40)
Cat. No.:
HY-P0265
Quantity:
MCE Japan Authorized Agent: