1. Neuronal Signaling
    Protein Tyrosine Kinase/RTK
  2. Trk Receptor
  3. BDNF(human)

BDNF(human) 

Cat. No.: HY-P1177
Handling Instructions

BDNF (human) is a neurotrophin in the central nervous system and mediates survival and differentiation of neurons. BDNF (human) binds to TrkB and leads to the dimerization and autophosphorylation of tyrosine residues in the intracellular domain of the receptor. BDNF (human) can be used for study of neurodegenerative and psychiatric disorder.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

BDNF(human) Chemical Structure

BDNF(human) Chemical Structure

CAS No. : 218441-99-7

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

BDNF (human) is a neurotrophin in the central nervous system and mediates survival and differentiation of neurons. BDNF (human) binds to TrkB and leads to the dimerization and autophosphorylation of tyrosine residues in the intracellular domain of the receptor. BDNF (human) can be used for study of neurodegenerative and psychiatric disorder[1][2].

IC50 & Target

IC50: TrkB[1]

Molecular Weight

13526.35

Formula

C₅₈₁H₉₄₁N₁₇₇O₁₇₇S₉

CAS No.

218441-99-7

Sequence Shortening

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYNRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

BDNF(human)Trk ReceptorTropomyosin related kinase receptorNeurotrophinpsychiatricdisorderneurodegenerativeInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BDNF(human)
Cat. No.:
HY-P1177
Quantity:
MCE Japan Authorized Agent: