1. Anti-infection
  2. Bacterial
  3. Beta-defensin 1, pig

Beta-defensin 1, pig 

Cat. No.: HY-P2290
Handling Instructions

Beta-defensin 1, pig is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Beta-defensin 1, pig Chemical Structure

Beta-defensin 1, pig Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Beta-defensin 1, pig is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans[1][2].

IC50 & Target

Bacterial[1]

In Vitro

Expression of beta-defensin (pBD-1) mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 are kidney and liver, whereas pBD-1 is mainly expressed in tongue[1].
An eight-fold increase in pBD-1 mRNA expression is observed upon S. typhimurium infection in the porcine intestinal cell line IPEC J2[1].
Porcine beta-defensin 1 (pBD-1) also has immunomodulatory activity in porcine peripheral blood mononuclear cells and lymph node cells[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Resistance against respiratory infection with B. pertussis in older piglets is associated with the presence of Porcine beta-defensin 1 (pBD-1) in the upper respiratory tract. Furthermore, treatment with pBD-1 conferred complete protection of newborn piglets from intrapulmonary infection with B. pertussis[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

7410.90

Formula

C₃₂₁H₅₃₄N₉₂O₉₀S₉

Sequence

Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala-Lys-Cys-Cys-Ile-Arg

Sequence Shortening

MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Beta-defensin 1, pigBacterialDefensinspBD-1pBD-2tongueintestineinnateimmuneantimicrobialrespiratoryinfectionspertussisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beta-defensin 1, pig
Cat. No.:
HY-P2290
Quantity:
MCE Japan Authorized Agent: