Elastase, Porcine pancreas  (Synonyms: EC 3.2.1.35; Pancreatopeptidase E)

Elastase, Porcine pancreas (EC 3.2.1.35) is a single polypeptide chain of 240 amino acid residues, derived from pig pancreas. Elastase, Porcine pancreas is a serine protease that can hydrolyze proteins and polypeptide. Elastase from porcine pancreas can induce emphysema in hamsters^[1][2][3].

In-Solution Digestion Protocol
1. Resuspend Elastase in double-distilled water to a final concentration of 1 mg/mL. Store reconstituted Elastase at 4℃ for up to 2 weeks.
2. Resuspend the protein in reaction buffer.
3. Add Elastase to protein solution; mix. We recommended using enzyme:protein ratios of 1:20 to 1:100.
4. Incubate 2-18 hours at 37℃.
5. Stop the reaction by adding 10% formic acid or TFA to a final concentration of 0.5% or by heating at 95℃ for 10 minutes.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Elastase from porcine pancreas induces emphysema in hamsters^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

25898.13

C₁₁₃₅H₁₇₅₉N₃₃₁O₃₄₆S₁₀

39445-21-1

Solid

White to off-white

VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGNGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN (Disulfide bridge: Cys30-Cys46; Cys127-Cys194; Cys158- Cys174; Cys184- Cys214)

[Elastase from porcine pancreas]

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Shotton DM, et, al. Amino-acid sequence of porcine pancreatic elastase and its homologies with other serine proteinases. Nature. 1970 Feb 28;225(5235):802-6.  [Content Brief]

  [2]. Teshima T, et, al. A new class of heterocyclic serine protease inhibitors. Inhibition of human leukocyte elastase, porcine pancreatic elastase, cathepsin G, and bovine chymotrypsin A alpha with substituted benzoxazinones, quinazolines, and anthranilates. J Biol Chem. 1982 May 10;257(9):5085-91.  [Content Brief]

  [3]. Stone PJ, et, al. Induction and exacerbation of emphysema in hamsters with human neutrophil elastase inactivated reversibly by a peptide boronic acid. Am Rev Respir Dis. 1990 Jan;141(1):47-52.  [Content Brief]