2. Apoptosis NF-κB Metabolic Enzyme/Protease Immunology/Inflammation
  3. Apoptosis Reactive Oxygen Species
  4. Epidermal growth factor (EGF)

Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Epidermal growth factor (EGF) Chemical Structure

Epidermal growth factor (EGF) Chemical Structure

CAS No. : 62253-63-8

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Epidermal growth factor (EGF):

Other Forms of Epidermal growth factor (EGF):

Epidermal growth factor (EGF) Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer[1][2].

IC50 & Target

Apoptosis, ROS[1][2].
In Vitro

Epidermal growth factor (EGF) (500 ng/mL; 0-20 min) can induce the production of ROS in A431 cells[1].
Epidermal growth factor (EGF)-induced tyrosine phosphorylation of various cellular proteins was completely blocked in A431 cells containing exogenous catalase[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Epidermal growth factor (EGF) Related Antibodies
In Vivo

Epidermal growth factor (EGF) (Osmotic pump delivered over 8 days at 10 pg/day) exhibits a highly significant stimulatory effect on wound closure in male mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: C57BL6J and CBA mice (0.5-cm2 full-thickness back wound was cut out of the center of the back)[3]
Dosage: 10 μg/day
Administration: Osmotic pump delivered over 8 days at 10 pg/day
Result: Exhibited a highly significant (P < 0.001) stimulatory effect on wound closure over 6 days in male mice.
Clinical Trial
Molecular Weight

6000-12000

CAS No.
Sequence

Asn-Ser-Asp-Ser-Glu-Cys-Pro-Leu-Ser-His-Asp-Gly-Tyr-Cys-Leu-His-Asp-Gly-Val-Cys-Met-Tyr-Ile-Glu-Ala-Leu-Asp-Lys-Tyr-Ala-Cys-Asn-Cys-Val-Val-Gly-Tyr-Ile-Gly-Glu-Arg-Cys-Gln-Tyr-Arg-Asp-Leu-Lys-Trp-Trp-Glu-Leu-Arg (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42)
Sequence Shortening

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Epidermal growth factor (EGF) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Epidermal growth factor (EGF)62253-63-8ApoptosisReactive Oxygen Speciescell survivalembryo developmentA431 cellswoundC57BL6J miceCBA miceInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Epidermal growth factor (EGF)
Cat. No.:
HY-P1960
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.