1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Adiponectin
  5. Adiponectin/Acrp30 Protein, Human

Adiponectin/Acrp30 Protein, Human

Cat. No.: HY-P7357
COA Handling Instructions

Adiponectin/Acrp30 Protein, Human is the globular head group of adiponectin, regulates fatty acid and glucose metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $390 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Adiponectin/Acrp30 Protein, Human is the globular head group of adiponectin, regulates fatty acid and glucose metabolism.

Background

Adiponectin is a 30-kDa adipose-derived hormone that appears to play an important role in regulating energy homeostasis and insulin sensitivity. The globular head group of adiponectin (gAcrp30) reduces plasma glucose levels and ameliorates insulin resistance in mice[1].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15848 (K101-N244)

Gene ID
Molecular Construction
N-term
Acrp30 (K101-N244)
Accession # Q15848
C-term
Synonyms
rHugAcrp30/Adipolean; Adiponectin; ACRP30; APM-1; ADIPOQ; ACDC
AA Sequence

KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Weight

Approximately 16.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Documentation
References

Adiponectin/Acrp30 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adiponectin/Acrp30 Protein, Human
Cat. No.:
HY-P7357
Quantity:
MCE Japan Authorized Agent: