1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin A1a Protein, Mouse (HEK293, His)

Serpin A1a Protein, Mouse (HEK293, His)

Cat. No.: HY-P7491
Handling Instructions

Alpha-1 protease inhibitor 1 Protein, Mouse (HEK293, His) is a mouse recombinant Serpin A1a with a His tag at the C-terminus. Alpha-1 protease inhibitor 1 Protein, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Glu25-Lys413 is expressed.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Serpin A1a Protein, Mouse (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

HEK 293

Accession

P07758 (E25-K413)

Gene ID

20700

Synonyms
rMuAlpha-1-antitrypsin 1-1, His; Serpin A1a; Alpha-1-antitrypsin 1-1
AA Sequence

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHKHHHHHH

Molecular Weight

Approximately 52.0 kDa

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Alpha-1-antitrypsin 1-1 (Serpin A1a; AAT) is the most abundant circulating serine protease inhibitor (serpin) and the prototypic member of the serpin super family. The 52-kD Serpin A1a protein is coded by the gene SERPINA1. Serpin A1a plays an important role in modulating immunity, inflammation, proteostasis, apoptosis, and possibly cellular senescence programs. Systemic deficiency in Serpin A1a due to genetic mutations can result in liver failure and chronic lung disease such as emphysema[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A1a Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7491
Quantity:
MCE Japan Authorized Agent: