Alpha-hemolysin Protein, S. aureus (P.pastoris, His)

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Alpha-hemolysin Protein interacts with the membranes of eukaryotic cells, triggering the release of low-molecular-weight molecules and ultimately causing osmotic lysis. Additionally, it is implicated in the inhibition of host neutrophil chemotaxis to the lesion region. The lytic activity of this protein necessitates heptamer oligomerization and pore formation. It undergoes self-assembly, initially forming a non-lytic oligomeric intermediate and subsequently adopting a mushroom-shaped homoheptamer structure, measuring up to 100 Angstroms in length and diameter. These structural features highlight the intricate mechanisms by which Alpha-hemolysin engages with cellular membranes and orchestrates processes leading to cell lysis and immune response modulation.

Staphylococcus aureus

P. pastoris

N-6*His

Q2G1X0 (27A-319N)

3920722  [NCBI]

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Approximately 35.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.