1. Recombinant Proteins
  2. Apolipoprotein D Protein, Human (HEK293, His)

Apolipoprotein D Protein, Human (HEK293, His)

Cat. No.: HY-P7530
Handling Instructions

Apolipoprotein D Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Human apolipoprotein D (ApoD) play a role in several pathological processes, especially in relation to cancer and certain neurological disorders[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuApolipoprotein D, His; ApoD; Apolipoprotein D
Species

Human

Source

HEK 293

Accession

P05090 (Q21-S189)

Gene ID

347

Molecular Weight

Approximately 28.0 kDa

AA Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSHHHHHH

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human apolipoprotein D (ApoD), a glycoprotein of 169 amino acids, is a functionally important member of the lipocalin family of proteins[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein D Protein, Human (HEK293, His)
Cat. No.:
HY-P7530
Quantity:
MCE Japan Authorized Agent: