APOD Protein, Human (HEK293, His)

APOD Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Human apolipoprotein D (ApoD) play a role in several pathological processes, especially in relation to cancer and certain neurological disorders^[1].

Human apolipoprotein D (ApoD), a glycoprotein of 169 amino acids, is a functionally important member of the lipocalin family of proteins^[1].

Human

HEK293

C-6*His

P05090 (Q21-S189)

347  [NCBI]

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSHHHHHH

Approximately 28.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Nasreen A, et al. Solubility engineering and crystallization of human apolipoprotein D. Protein Sci. 2006 Jan;15(1):190-9.  [Content Brief]