B2M/Beta-2 microglobulin Protein, Cynomolgus (99a.a, HEK293, His)

B2M, also known as Beta-2 microglobulin, is a key component of the class I major histocompatibility complex (MHC) and plays a crucial role in presenting peptide antigens to the immune system (by similarity) . The protein forms a heterodimer with the α chain and specifically constitutes (by similarity) the β chain of major histocompatibility complex class I molecules. B2M/Beta-2 microglobulin Protein, Cynomolgus (99a.a, HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B2M/Beta-2 microglobulin Protein, Cynomolgus (99a.a, HEK293, His) is 99 a.a., with molecular weight of ~14.0 kDa.

Beta-2 microglobulin (B2M) is a crucial component of the class I major histocompatibility complex (MHC), playing a pivotal role in the immune system's recognition of foreign substances. It is involved in presenting peptide antigens to the immune system, facilitating the surveillance and response to potential threats. B2M forms a heterodimer with an alpha chain, collectively constituting major histocompatibility complex class I molecules. This heterodimeric complex is essential for antigen presentation, a process vital for immune surveillance and the activation of immune responses. Ongoing research may further uncover the nuanced functions and implications of B2M in immune system regulation.

Cynomolgus

HEK293

C-6*His

Q8SPW0 (I21-M119)

101867173  [NCBI]

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.