1. Recombinant Proteins
  2. B7-2/CD86 Protein, Human (HEK293, Fc-His)

B7-2/CD86 Protein, Human (HEK293, Fc-His)

Cat. No.: HY-P7323
Handling Instructions

B7-2/CD86 Protein, Human (HEK293, Fc-His) is a polypeptide chain with the C-termimal human Fc-His Tag produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $110 Ask For Quote & Lead Time
50 μg $210 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuB7-2/CD86, Fc-His; Activation B7-2 antigen; B70; BU63; CD86; CD28LG2
Species

Human

Source

HEK 293

Accession

P42081 (L20-P247)

Gene ID

942

Molecular Weight

45-55 kDa

AA Sequence

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPHHHHHH

Biological Activity
5 µg/mL (100 µL/well) of immoblized recombinant human B7-2/CD86, Fc-His can bind human CTLA-4-Fc with a linear range of 0.977-7.813 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, 5% trehalose and mannitol.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CD86 is a transmembrane region, and a longer cytoplasmic domain than CD80. CD86 is constitutively expressed on interdigitating dendritic cells (DCs), Langerhans cells, peripheral blood DCs, memory B cells and germinal center B cells, and macrophages. CD86 is rapidly upregulated on B cells following activation by cross-linking of the Ig receptor or the addition of a variety of cytokines[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-2/CD86 Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P7323
Quantity:
MCE Japan Authorized Agent: