1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Betacellulin
  5. Betacellulin/BTC Protein, Mouse (His)

Betacellulin/BTC Protein, Mouse (His)

Cat. No.: HY-P70073
Handling Instructions

Betacellulin (BTC) is missing crucial conserved residue(s) for feature annotation propagation. Betacellulin/BTC Protein, Mouse (His) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by E. coli , with N-6*His labeled tag. The total length of Betacellulin/BTC Protein, Mouse (His) is 87 a.a., with molecular weight of 13-16 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7329

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Betacellulin (BTC) is missing crucial conserved residue(s) for feature annotation propagation. Betacellulin/BTC Protein, Mouse (His) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by E. coli , with N-6*His labeled tag. The total length of Betacellulin/BTC Protein, Mouse (His) is 87 a.a., with molecular weight of 13-16 kDa.

Background

Betacellulin (BTC) lacks conserved residue(s) essential for the propagation of feature annotation.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q543J8 (D32-Q118)

Gene ID

12223  [NCBI]

Molecular Construction
N-term
6*His
BTC (D32-Q118)
Accession # Q543J8
C-term
Synonyms
rMuBetacellulin/Btc, His; Btc; Betacellulin; Betacellulin; epidermal growth factor family member; Betacellulin; epidermal growth factor family member; isoform CRA_a; mCG_12529
AA Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ

Molecular Weight

13-16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Betacellulin/BTC Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Betacellulin/BTC Protein, Mouse (His)
Cat. No.:
HY-P70073
Quantity:
MCE Japan Authorized Agent: