BMP-9/GDF-2 Protein, Mouse (HEK293, Fc)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that signals through AVRL1, and endoglin/ENG is required for SMAD1 signaling in endothelial cells. As a homodimer with a disulfide-linked structure, BMP-9/GDF-2 forms a complex with AVRL1, BMPR2, and ACVR2B, which is critical for its signaling cascade. BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived BMP-9/GDF-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-50 kDa.

BMP-9/GDF-2 Protein emerges as a potent circulating inhibitor of angiogenesis, signaling through the type I activin receptor ACVRL1 while excluding other Alks. In endothelial cells, its signaling through SMAD1 necessitates the presence of the TGF-beta coreceptor endoglin/ENG. Existing as a homodimer with disulfide-linked structures, BMP-9/GDF-2 is detected in extracellular fluid both as a mature homodimer and in complex with its propeptide. The protein engages in high-affinity interactions with ACVRL1, BMPR2, and ACVR2B, forming complexes pivotal for its signaling cascade. Additionally, BMP-9/GDF-2 interacts with ENG, forming a heterotetramer with a 2:2 stoichiometry, and can also engage in heteromeric complexes with ENG and ACVRL1. Notably, it interacts with the type I receptor ACVR1, adding another layer of complexity to its regulatory interactions within the TGF-beta signaling pathway.

Mouse

HEK293

C-hFc

Q9WV56 (S319-R428)

12165  [NCBI]

STGASSHCQKTSLRVNFEDIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISILYKDDMGVPTLKYHYEGMSVAECGCR

47-50 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in 100 mM Glycine,40 mM Tris.100 mM NaCl, pH 8.14. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.