1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory checkpoint molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Human (134a.a, HEK293, Fc)

BTLA/CD272 Protein, Human (134a.a, HEK293, Fc)

Cat. No.: HY-P72858
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized BTLA/CD272 Protein, Human (HEK293, Fc) at 10μg/mL (100μL/well) can bind mouse HVEM-hFc and the EC50 is 6-70ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q7Z6A9 (M1-T134)

Gene ID
Synonyms
B-and T-lymphocyte attenuator; CD272; BTLA
AA Sequence

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVT

Molecular Weight

Approximately 42.2 kDa

Purity

Greater than 90 % as determined by SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BTLA/CD272 Protein, Human (134a.a, HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTLA/CD272 Protein, Human (134a.a, HEK293, Fc)
Cat. No.:
HY-P72858
Quantity:
MCE Japan Authorized Agent: