Cathepsin B Protein, Human (His)

Cathepsin B Protein, a thiol protease, is crucial for intracellular protein degradation, cleaving matrix extracellular phosphoglycoprotein MEPE. It's implicated in solubilizing cross-linked TG/thyroglobulin in the thyroid follicle lumen. Associated with tumor invasion and metastasis, Cathepsin B signifies potential relevance in cancer-related pathways. Cathepsin B Protein, Human (His) is the recombinant human-derived Cathepsin B protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cathepsin B Protein, Human (His) is 322 a.a., with molecular weight of 34 & 38-50 kDa, respectively.

Cathepsin B Protein, a thiol protease, is thought to play a crucial role in intracellular protein degradation and turnover. This enzyme cleaves matrix extracellular phosphoglycoprotein MEPE and is implicated in the solubilization of cross-linked TG/thyroglobulin within the thyroid follicle lumen. Beyond its role in cellular processes, Cathepsin B has been associated with tumor invasion and metastasis, highlighting its potential significance in cancer-related pathways.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

AAH10240.1 (R18-I339)

1508  [NCBI]

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

34&38-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.