CDC42 Protein, Human (GST)

CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (GST) is the recombinant human-derived CDC42 protein, expressed by E. coli , with N-GST labeled tag. The total length of CDC42 Protein, Human (GST) is 188 a.a., with molecular weight of ~44 kDa.

CDC42, a plasma membrane-associated small GTPase, dynamically transitions between an active GTP-bound state and an inactive GDP-bound state, modulating diverse cellular responses by interacting with various effector proteins. Notably, CDC42 is intricately involved in processes such as epithelial cell polarization, where it plays a critical role in regulating spindle microtubule attachment to kinetochores before chromosome congression in metaphase. Additionally, CDC42 influences cell migration and is pivotal for the extension and maintenance of filopodia, slender actin-rich projections, in neurons. In the context of neuronal plasticity, it participates in CaMKII-mediated signaling, impacting dendritic spine structural plasticity and contributing to long-term synaptic changes. Moreover, CDC42 is essential for the formation of spines in specific neuronal cell types, such as Purkinje cells and hippocampal neurons, through interactions with DOCK10 and DOCK11. In podocytes, it facilitates the formation of filopodia and podosomes upon activation by DOCK11. Furthermore, CDC42 plays a crucial role in the orchestration of F-actin cytoskeleton dynamics during phagocytosis, contributing to the formation of phagocytic cups. This multifaceted engagement underscores the versatility of CDC42 in regulating various cellular functions.

Human

E. coli

N-GST

P60953-2 (M1-C188)

998  [NCBI]

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC

Approximately 44 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 0.15M NaCl, 0.5 mM GSH, pH 8.0 or 20 mM Tris-HCL, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.