TNFRSF10C, Human (HEK 293, His)

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C, Human (HEK 293, His) is the recombinant human-derived TNFRSF10C, expressed by HEK293 , with C-6*His labeled tag. The total length of TNFRSF10C, Human (HEK 293, His) is 196 a.a., with molecular weight of ~40.0 kDa.

The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.

Human

HEK293

C-6*His

O14798 (A26-A221)

8794  [NCBI]

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<11 EU/μg, determined by LAL method.