1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Cathepsin B Protein, Human (322a.a, HEK293, His)

Cathepsin B Protein, Human (322a.a, HEK293, His)

Cat. No.: HY-P71996
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Stock
10 μg   Get quote  
50 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin B Protein, Human (322a.a, HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Tag

C-6His

Accession

P07858 (R18-I339)

Gene ID

1508

Synonyms
Amyloid precursor protein secretase; APP secretase; APPS; CATB_HUMAN; Cathepsin B heavy chain; Cathepsin B1; CathepsinB; CPSB; CTSB; cysteine protease; OTTHUMP00000116009; OTTHUMP00000229510; OTTHUMP00000229511; OTTHUMP00000229512; OTTHUMP00000229514; OTTHUMP00000229515; OTTHUMP00000229516; Preprocathepsin B
AA Sequence

RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Molecular Weight

Approximately 36.9 kDa

Purity

Greater than 95% as determined by SDS-PAGE.

Biological Activity
Specific activity as determined by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC is greater than 3000 pmol/min/μg.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin B Protein, Human (322a.a, HEK293, His)
Cat. No.:
HY-P71996
Quantity:
MCE Japan Authorized Agent: