1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-1/CXCL12
  6. SDF-1 alpha/CXCL12 Protein, Mouse (Tag free)

SDF-1 alpha/CXCL12 Protein, Mouse (Tag free)

Cat. No.: HY-P70518
Handling Instructions

CXCL12 (stromal cell-derived factor-1, SDF-1) is a homeostatic chemokine that binds CXCR4 and CXCR7 receptors and physiologically functions in hematopoiesis, leucocyte trafficking, cardiogenesis, and neurogenesis. CXCL12 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. CXCL12 has an essential role in neural and vascular development, hematopoiesis, cancer and in immunity. CXCL12 Protein, Mouse is produced in E. coli, and consists of 68 amino acids (K22-K89).

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7285

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL12 (stromal cell-derived factor-1, SDF-1) is a homeostatic chemokine that binds CXCR4 and CXCR7 receptors and physiologically functions in hematopoiesis, leucocyte trafficking, cardiogenesis, and neurogenesis. CXCL12 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. CXCL12 has an essential role in neural and vascular development, hematopoiesis, cancer and in immunity[1][2][3]. CXCL12 Protein, Mouse is produced in E. coli, and consists of 68 amino acids (K22-K89).

Background

CXCL12 (SDF-1), is a small protein that belongs to the chemokine family, whose members have a crucial role in directing cell migration. It is ubiquitously expressed in many tissues and cell types. CXCL12 acts through two receptors, CXCR4 and CXCR7. While the former is a classic G protein-coupled transmembrane chemokine receptor, the latter primarily function as a scavenger of CXCL12. CXCL12 is a chemoattractant for T-lymphocytes and monocytes, but not neutrophils[1][2][3].
CXCL12 gene in human is located on chromosome 10 (10q11.21) and recognizes seven isoforms deriving from alternative gene splicing (α, β, γ, δ, ε, θ) with α and β being the most studied and three (CXCL12α to γ) in mice. CXCL12 is described classically as a homing chemokine as it exhibits chemoattraction of tumoral cells toward the target tissues. CXCL12, although being homeostatic in classification, also takes inflammatory activities. CXCL12 binds to glycosaminoglycans (GAGs) exposed on the surface of endothelial cells through a cluster of basic residues-the BBXB motif (B for basic amino acid and X any amino acid) generating its chemotactic gradients and promoting leukocyte/cancer cell migration. CXCL12/CXCR4 axis is involved in tumor progression, angiogenesis, metastasis, and survival. CXCR7 binds with high-affinity CXCL12 and with lower-affinity CXCL11. Although CXCR7 acts as a CXCL12 scavenger through ligand internalization and degradation, it transduces the signal mainly through β-arrestin with a pivotal role in endothelial and neural cells. CXCL12 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. CXCL12 secretion is also associated with tissue damage such as heart infarct, limb ischemia, toxic liver damage, excessive bleeding, total body irradiation, and after tissue damage related to chemotherapy. CXCR4 is expressed by endothelial cells and pericytes of hypoxic, injured, or pathological tissues, including injured carotid arteries and atherosclerotic plaques[1][2].
CXCL12 has been considered as a standard pro-inflammatory molecule for a long time, as it attracts leukocytes to inflammatory sites and contributes to their activation. CXCL12 is very importantfor vascularization, hematopoiesis and neuronal development, but also for HIV-infection and cancer metastasis. CXCL12 plays a classic chemokine role in immune response by attracting activated, CXCR4+ T cells and monocytes to the sites of inflammation. However, CXCL12 plays an anti-inflammatory role in neuroinflammatory demyelinating disorders ofthe CNS, i.e. inmultiple sclerosis (MS) and its animal model experimental autoimmune encephalomyelitis (EAE). In addition, CXCL12 targeting affects tumor primary growth, mesenchymal transition, and migration but also shapes the tumor microenvironment (TME) toward immunoresponsive TME[1][2][3].

In Vitro

Recombinant mouse CXCL12 (50-400 ng/mL) results in dose-dependent migration of cytokine-treated cells in GFP+ neural stem cells (NSCs)[4].

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P40224 (K22-K89)

Gene ID

20315  [NCBI]

Molecular Construction
N-term
CXCL12 (K22-K89)
Accession # P40224
C-term
Synonyms
Cxcl12; Stromal cell-derived factor 1; SDF-1; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymic lymphoma cell-stimulating factor; TLSF; Sdf1
AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Weight

Approximately 10.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

SDF-1 alpha/CXCL12 Protein, Mouse (Tag free) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDF-1 alpha/CXCL12 Protein, Mouse (Tag free)
Cat. No.:
HY-P70518
Quantity:
MCE Japan Authorized Agent: