1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Human

EGF Protein, Human

Cat. No.: HY-P7109
SDS COA Handling Instructions

EGF Protein is a potent epidermal growth factor that belongs to EGF-family of proteins. EGF Protein stimulates cell growth and differentiation by binding to epidermal growth factor receptor (EGFR) found in many human tissues, including platelets, submandibular gland (submaxillary gland) and parotid gland. EGF Protein has effects such as wound healing, anti-intestinal atrophy, anti-cancer, reducing ureteral obstruction and assisting in nerve tissue regeneration, mainly used in wound healing applications. EGF Protein (Human) is a recombinant protein with tag free that consists of 53 amino acids with three intramolecular disulfide bonds and is produced in E. coli[1],[2],[3],[4],[5],[6],[7].

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $30 In-stock
10 μg $45 In-stock
50 μg $70 In-stock
100 μg $90 In-stock
250 μg $130 In-stock
500 μg $170 In-stock
1 mg $220 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE EGF Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF Protein is a potent epidermal growth factor that belongs to EGF-family of proteins. EGF Protein stimulates cell growth and differentiation by binding to epidermal growth factor receptor (EGFR) found in many human tissues, including platelets, submandibular gland (submaxillary gland) and parotid gland. EGF Protein has effects such as wound healing, anti-intestinal atrophy, anti-cancer, reducing ureteral obstruction and assisting in nerve tissue regeneration, mainly used in wound healing applications. EGF Protein (Human) is a recombinant protein with tag free that consists of 53 amino acids with three intramolecular disulfide bonds and is produced in E. coli[1],[2],[3],[4],[5],[6],[7].

Background

Recombinant Human Epidermal Growth Factor is chemically identical to the natural material, exhibits full biological activity and is ued in wound healing applications. Recombinant Human Epidermal Growth Factor (rhEGF) stimulates proliferation of the fibroblast BALB/c3T3 cell line. Recombinant Human Epidermal Growth Factor released from hydrogels keeps its bioactivity, induces EGF receptor expression, causes proliferating cell nuclear antigen and shows therapeutic potential in enhancing diabetic wound healing[1,2].
EGF Protein (Human) promotes cellular proliferation, differentiation and survival by binding to epidermal growth factor receptor (EGFR) on the cell surface with high affinity[1].
The biological effects of salivary EGF Protein (Human) include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents[3].
EGF Protein (Human) works as an enhancer of mineralization during differentiation of mesenchymal stem cells (MSCs) derived from bone marrow. EGF Protein (Human) is capable of increasing calcium deposit formation as well as ALP and OCN gene expression, which is promising for research of an effective adjuvant to improve bone regeneration in periodontics and oral implantology[4,5].

In Vitro

EGF Protein (Human) (10 ng/mL, 7 days) shows polygonalshaped appearance with spherical-peripheral nuclei, low cytoplasm content and shows strongt inhibitory effect on the expression levels of CD146 and CD10 in dental pulp stem cells (DPSCs)[4].
EGF Protein (Human) (10 ng/mL, 21 days) induces a clear increase in abundance and size of calcium deposit, as well as in the mineralization levels evaluated by Alizarin red S (ARS) (HY-120601) (1686.31 μg/mL)[4].
EGF Protein (Human) significantly enhances tyrosine phosphorylation, increases activity of alkaline phosphatase and enhances formation of mineralization nodules in human mesenchymal stem cells (hMSC)[5].
EGF Protein (Human) (10 ng/μL, 21 days) promotes the Sox10-mediated astrocyte fate switch to oligodendrocyte precursor cells (iOPCs) which are capable of further diferentiating into myelinating oligodendrocytes (OLs)[7].

In Vivo

EGF Protein (Human) (10 μg/g, cream, a single dose for 7 days) reduces inflammatory infiltrate and results in wound re-epithelialization in rats with full thicknessskin wounds[1].
EGF Protein (Human) (50 μg/g, cream, every 24 h for 7 days) significantly stimulates re-epithelialization at high levels, preferably in combination with a protease inhibitor in pigs with thickness wounds on the back[1].
EGF Protein (Human) (30 μg/kg, s.c., daily for 3 weeks) attenuates the oesophageal damage normally caused by the sclerotherapy (surgical dilation of the oesophagus) procedure in Gottingen minipigs[1].

Biological Activity

Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is <300 pg/mL.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 53.08 pg/mL, corresponding to a specific activity is 1.88×107 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01133-1 (N971-R1023)

Gene ID
Molecular Construction
N-term
EGF (N971-R1023)
Accession # P01133
C-term
Synonyms
rHuEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

Approximately 7-10 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Phosphate buffer, pH 7.0, 200 mM NaCl or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM Tris, 200 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 200 mM NaCl, pH 8.0 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

EGF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Human
Cat. No.:
HY-P7109
Quantity:
MCE Japan Authorized Agent: