2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. TGF-beta Superfamily
  5. Growth Differentiation Factor
  6. Growth Differentiation Factor-8 (GDF-8)
  7. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc)

GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc)

Cat. No.: HY-P74127
SDS COA Handling Instructions

The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.
Background

The GDF-8 protein, also known as myostatin, acts specifically as a negative regulator of skeletal muscle growth. It functions as a homodimer that is disulfide-linked. Additionally, it interacts with WFIKKN2, leading to the inhibition of its activity. Furthermore, it has been found to interact with FSTL3.
Species

Rat; Mouse; Human
Source

HEK293
Tag

N-hFc
Accession

O08689 (D268-S376)
Gene ID
Molecular Construction
N-term
hFc
GDF-8 (D268-S376)
Accession # O08689
C-term
Synonyms
Growth/differentiation factor 8; GDF-8; Myostatin; MSTN
AA Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Weight

Approximately 40 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
SDS (251 KB)

COA (220 KB)

Handling Instructions (2659 KB)

GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc)
Cat. No.:
HY-P74127
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.