1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. HTRA2/OMI Protein, Human (HEK293, His)

HTRA2/OMI Protein, Human (HEK293, His)

Cat. No.: HY-P70204
Handling Instructions

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms. It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity. Additionally, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 lacks apparent proteolytic activity. HTRA2/OMI Protein, Human (HEK293, His) is the recombinant human-derived HTRA2/OMI protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HTRA2/OMI Protein, Human (HEK293, His) is 325 a.a., with molecular weight of 39-43 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms. It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity. Additionally, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 lacks apparent proteolytic activity. HTRA2/OMI Protein, Human (HEK293, His) is the recombinant human-derived HTRA2/OMI protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HTRA2/OMI Protein, Human (HEK293, His) is 325 a.a., with molecular weight of 39-43 kDa.

Background

HTRA2/OMI, a serine protease, exhibits proteolytic activity against a non-specific substrate, beta-casein. It plays a pivotal role in cell death induction through multiple mechanisms. One mechanism involves direct binding to and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to heightened caspase activity. Alternatively, HTRA2/OMI can induce cell death through a BIRC inhibition-independent, caspase-independent pathway, relying on its serine protease activity. Furthermore, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 appears to lack proteolytic activity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O43464 (A134-E458)

Gene ID
Molecular Construction
N-term
HTRA2 (A134-E458)
Accession # O43464
6*His
C-term
Synonyms
rHuSerine protease HTRA2/HTRA2, His; Serine protease HTRA2; mitochondrial; High temperature requirement protein A2; HtrA2; Omi stress-regulated endoprotease; Serine protease 25; Serine proteinase OMI; HTRA2; OMI; PRSS25
AA Sequence

AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

Molecular Weight

39-43 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HTRA2/OMI Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HTRA2/OMI Protein, Human (HEK293, His)
Cat. No.:
HY-P70204
Quantity:
MCE Japan Authorized Agent: