1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. multi-CSF/IL-3
  5. IL-3 Protein, Rat (CHO, His)

IL-3 Protein, Rat (CHO, His)

Cat. No.: HY-P7375
Handling Instructions

IL-3 Protein, Rat (CHO, His) is a growth factor for a variety of hematopoietic progenitor cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $360 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-3 Protein, Rat (CHO, His) is a growth factor for a variety of hematopoietic progenitor cells.

Background

Interleukin-3 is a growth factor for a variety of hematopoietic progenitor cells[1].

Biological Activity
The ED50 is <8 ng/mL as measured by NFS-60 cells.
Species

Rat

Source

CHO

Tag

C-His

Accession

P97688 (I27-C169)

Gene ID

24495  [NCBI]

Synonyms
rRtIL-3, His; MCGF; Hematopoietic growth factor; P-cell stimulation factor
AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Molecular Weight

22-34 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-3 Protein, Rat (CHO, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Rat (CHO, His)
Cat. No.:
HY-P7375
Quantity:
MCE Japan Authorized Agent: