Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution)

Insulin-1, a vital regulator of glucose, efficiently reduces blood glucose by enhancing cellular permeability to monosaccharides, amino acids, and fatty acids. Its actions span glycolysis acceleration, pentose phosphate cycle promotion, and liver glycogen synthesis facilitation. Structurally, Insulin-1 is a heterodimer with A and B chains linked by two disulfide bonds, emphasizing its pivotal role in coordinating metabolic processes crucial for glucose homeostasis. Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P. pastoris , with N-His, C-Myc labeled tag. The total length of Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution) is 84 a.a., with molecular weight of ~25 kDa.

Insulin-1, a key player in glucose regulation, effectively lowers blood glucose levels by enhancing cellular permeability to monosaccharides, amino acids, and fatty acids. Its multifaceted actions include the acceleration of glycolysis, promotion of the pentose phosphate cycle, and facilitation of glycogen synthesis in the liver. Structurally, Insulin-1 exists as a heterodimer comprising a B chain and an A chain, intricately linked by two disulfide bonds. These structural features underscore its crucial role in orchestrating metabolic processes essential for maintaining glucose homeostasis.

Mouse

P. pastoris

N-His;C-Myc

P01325(25F-108N)

16333  [NCBI]

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Approximately 25 kDa

Greater than 90 % as determined by SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of Tris-based buffer,50% glycerol.

<1 EU/ug, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.