Kallikrein-3/PSA Protein, Human (244a.a, HEK293, C-His)

Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, C-His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Kallikrein-3/PSA Protein, Human (244a.a, HEK293, C-His) is 244 a.a., with molecular weight of approximately 30 kDa.

Kallikrein-3 (PSA) protein plays a pivotal role in the male reproductive system by hydrolyzing semenogelin-1, a seminal vesicle protein. This enzymatic activity is responsible for initiating the liquefaction of the seminal coagulum, a critical step in sperm mobility and overall fertility. PSA's ability to cleave semenogelin-1 underscores its significance in the intricate processes involved in semen physiology and male reproductive function.

Human

HEK293

C-10*His

P07288 (A18-P261)

354  [NCBI]

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.