1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-8 Protein, Human (232a.a, HEK293, His)

Kallikrein-8 Protein, Human (232a.a, HEK293, His)

Cat. No.: HY-P70169
Handling Instructions

Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Human (232a.a, HEK293, His) is the recombinant human-derived Kallikrein-8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-8 Protein, Human (232a.a, HEK293, His) is 232 a.a., with molecular weight of ~35.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Human (232a.a, HEK293, His) is the recombinant human-derived Kallikrein-8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-8 Protein, Human (232a.a, HEK293, His) is 232 a.a., with molecular weight of ~35.0 kDa.

Background

Kallikrein-8, a serine protease, exhibits the capability to degrade various proteins, including casein, fibrinogen, kininogen, fibronectin, and collagen type IV. Moreover, it cleaves L1CAM in response to heightened neural activity, thereby inducing neurite outgrowth and fasciculation in cultured hippocampal neurons. This protease plays a pivotal role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus, and is essential for memory acquisition and synaptic plasticity. Additionally, Kallikrein-8 is involved in skin desquamation and keratinocyte proliferation, contributing to these processes. Furthermore, it plays a significant role in the secondary phase of pathogenesis following spinal cord injury, underscoring its diverse functions in neural and cutaneous processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH40887.1 (Q29-G260)

Gene ID
Molecular Construction
N-term
Kallikrein-8 (Q29-G260)
Accession # AAH40887.1
6*His
C-term
Synonyms
rHuKallikrein 8/KLK8, His; Kallikrein-8; hK8; Neuropsin; NP; Ovasin; Serine Protease 19; Serine Protease TADG-14; Tumor-Associated Differentially Expressed Gene 14 Protein; KLK8; NRPN; PRSS19; TADG14
AA Sequence

QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Kallikrein-8 Protein, Human (232a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-8 Protein, Human (232a.a, HEK293, His)
Cat. No.:
HY-P70169
Quantity:
MCE Japan Authorized Agent: