2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. FGF Family
  5. Fibroblast Growth Factor
  6. FGF-10
  7. KGF-2/FGF-10 Protein, Human (171a.a)

KGF-2/FGF-10 Protein, Human (171a.a)

Cat. No.: HY-P70695
Handling Instructions

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (171a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with tag free. The total length of KGF-2/FGF-10 Protein, Human (171a.a) is 171 a.a., with molecular weight of 19-22 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7048

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. KGF-2/FGF-10 Protein, Human (171a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli , with tag free. The total length of KGF-2/FGF-10 Protein, Human (171a.a) is 171 a.a., with molecular weight of 19-22 kDa.
Background

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.
Species

Human
Source

E. coli
Tag

Tag Free
Accession

O15520 (Q38-S208)
Gene ID
Molecular Construction
N-term
FGF-10 (Q38-S208)
Accession # O15520
C-term
Synonyms
Fibroblast growth factor 10; FGF-10; Keratinocyte growth factor 2; FGF10; KGF-2; KGF2
AA Sequence

QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Weight

19-22 kDa
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

KGF-2/FGF-10 Protein, Human (171a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF-2/FGF-10 Protein, Human (171a.a)
Cat. No.:
HY-P70695
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.