2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. FGF Family
  5. Fibroblast Growth Factor
  6. Fibroblast Growth Factor 7 (FGF-7)
  7. KGF/FGF-7 Protein, Mouse

KGF/FGF-7 Protein, Mouse

Cat. No.: HY-P7230
Handling Instructions

KGF/FGF-7 Protein, Mouse is a polypeptide mitogen that belongs to the family of fibroblast growth factors. It binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Mouse and its receptor are important for normal wound healing.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7176

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

KGF/FGF-7 Protein, Mouse is a polypeptide mitogen that belongs to the family of fibroblast growth factors. It binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Mouse and its receptor are important for normal wound healing.
Background

Recombinant Mouse KGF/FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors. It binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. Recombinant Human Keratinocyte Growth Factor 1/FGF-7 and its receptor are important for normal wound healing.
Species

Mouse
Source

E. coli
Tag

Tag Free
Accession

P36363(C32-T194)
Gene ID

14178  [NCBI]
Molecular Construction
N-term
FGF-7 (C32-T194)
Accession # P36363
C-term
Synonyms
rMuKGF/FGF-7; Fibroblast Growth Factor-7; HBGF-7
AA Sequence

CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Molecular Weight

Approximately 18.7 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<0.2 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)
References

KGF/FGF-7 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF/FGF-7 Protein, Mouse
Cat. No.:
HY-P7230
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.