KRAS Protein, Human (G13V, His)

KRAS Protein, a pivotal Ras family member, binds GDP/GTP and possesses intrinsic GTPase activity. Its crucial role in regulating cell proliferation emphasizes its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), inducing transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality underscores KRAS as a key player in cellular dynamics, relevant in both normal and pathological processes. KRAS Protein, Human (G13V, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13V mutation. The total length of KRAS Protein, Human (G13V, His) is 184 a.a., with molecular weight of ~25 kDa.

KRAS, a pivotal member of the Ras protein family, exhibits the ability to bind GDP/GTP and possesses intrinsic GTPase activity. Its crucial involvement in the regulation of cell proliferation underscores its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), where it induces transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality highlights KRAS as a key player in cellular dynamics and emphasizes its relevance in both normal and pathological cellular processes.

Measured by its ability to catalyze the substrate GTP. The specific activity is 0.24 nmol/min/mg, as measured under the described conditions.

Human

E. coli

N-6*His

AAH13572.1 (T2-C185, G13V)

3845  [NCBI]

TEYKLVVVGAGVVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Approximately 25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.