1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. L-Selectin/CD62L L-Selectin/CD62L Selectin
  5. L-Selectin/CD62L Protein, Human (294a.a, HEK293, His)

L-Selectin/CD62L Protein, Human (294a.a, HEK293, His)

Cat. No.: HY-P72511
Handling Instructions

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-Selectin/CD62L Protein, Human (294a.a, HEK293, His) is the recombinant human-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-6*His labeled tag. The total length of L-Selectin/CD62L Protein, Human (294a.a, HEK293, His) is 294 a.a., with molecular weight of ~56 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P74768

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-Selectin/CD62L Protein, Human (294a.a, HEK293, His) is the recombinant human-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-6*His labeled tag. The total length of L-Selectin/CD62L Protein, Human (294a.a, HEK293, His) is 294 a.a., with molecular weight of ~56 kDa.

Background

L-Selectin, also known as CD62L, is a calcium-dependent lectin that plays a crucial role in mediating cell adhesion by binding to glycoproteins on neighboring cells. Functionally, it facilitates the adherence of lymphocytes to endothelial cells within high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes in endothelial tissues. L-Selectin's interaction with SELPLG/PSGL1 and PODXL2 is vital for the recruitment and rolling of leukocytes. This interaction is specifically dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for effective L-Selectin binding. The multifaceted functions of L-Selectin underscore its significance in orchestrating cell adhesion processes and immune cell recruitment.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P14151 (W39-N332)

Gene ID
Molecular Construction
N-term
L-selectin (W39-N332)
Accession # P14151
6*His
C-term
Synonyms
L-selectin; LAM-1; LECAM1; TQ1; gp90-MEL; CD62L; SELL; LNHR; LYAM1
AA Sequence

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

Molecular Weight

Approximately 56 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

L-Selectin/CD62L Protein, Human (294a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
L-Selectin/CD62L Protein, Human (294a.a, HEK293, His)
Cat. No.:
HY-P72511
Quantity:
MCE Japan Authorized Agent: