LOX Protein, Human (His)

LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (His) is the recombinant human-derived LOX protein, expressed by E. coli , with N-His labeled tag. The total length of LOX Protein, Human (His) is 244 a.a., with molecular weight of ~32.4 kDa.

The LOX protein assumes a pivotal role in the post-translational oxidative deamination of peptidyl lysine residues within precursors to fibrous collagen and elastin, as highlighted by its involvement in the modification of these structural proteins. Acting as a regulator of Ras expression, LOX also exhibits potential implications in tumor suppression, suggesting a multifaceted role in cellular homeostasis and cancer-related processes. Additionally, the protein is implicated in shaping the architecture of the aortic wall, contributing to the structural integrity and function of this crucial vascular component. The diverse functions of LOX underscore its significance in extracellular matrix dynamics, Ras regulation, and potential tumor suppressive mechanisms, making it a key player in cellular and tissue homeostasis.

Human

E. coli

N-His

P28300 (P174-Y417)

4015  [NCBI]

PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Approximately 32.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.