1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-14
  5. MMP-14 Protein, Human (His-SUMO)

MMP-14 protein is an endopeptidase that degrades collagen and activates progelatinase A. MMP-14 Protein, Human (His-SUMO) is the recombinant human-derived MMP-14 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-14 protein is an endopeptidase that degrades collagen and activates progelatinase A. MMP-14 Protein, Human (His-SUMO) is the recombinant human-derived MMP-14 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

MMP-14 Protein serves as a critical endopeptidase, targeting various components of the extracellular matrix, notably collagen, and playing a pivotal role in pericellular collagenolysis during development, contributing to the modeling of both skeletal and extraskeletal connective tissues. Additionally, MMP-14 activates progelatinase A, acting as a key player in the intricate regulation of the extracellular matrix. Beyond its matrix-degrading functions, MMP-14 is implicated in actin cytoskeleton reorganization by cleaving PTK7, highlighting its involvement in cellular processes beyond matrix remodeling. Furthermore, MMP-14 acts as a positive regulator of cell growth and migration through the activation of MMP15 and plays a crucial role in the formation of fibrovascular tissues in conjunction with pro-MMP2. Notably, MMP-14 cleaves ADGRB1, releasing vasculostatin-40, which exerts anti-angiogenic effects by inhibiting angiogenesis. This multifaceted functionality underscores MMP-14's significance in orchestrating diverse cellular processes and its potential as a therapeutic target in various physiological contexts.

Biological Activity

Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is 3373.72 pmol/min/µg, as measured under the described conditions. (Activate rhMMP-14 at 80 µg/mL with 1.72 µg/mL rhFurin in Activation Buffer (50 mM Tris, 1 mM CaCl2, 0.5% (w/v) Brij-35, pH 9.0), incubate at 37°C for 1.5 hours)

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P50281 (Y112-V582)

Gene ID
Molecular Construction
N-term
6*His-SUMO
MMP-14 (Y112-V582)
Accession # P50281
C-term
Synonyms
Matrix metalloproteinase 14 ; Matrix metalloproteinase-14; Membrane type 1 matrix metalloproteinase ; Membrane type 1 metalloprotease; Membrane type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase; MMP 14; MMP X1; MMP-14; MMP-X1; Mmp14; MMP14_HUMAN; MMPX1; MT MMP 1;
AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Molecular Weight

Approximately 69.9 kDa.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-14 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-14 Protein, Human (His-SUMO)
Cat. No.:
HY-P700007
Quantity:
MCE Japan Authorized Agent: