MMP-14 Protein, Human (His-SUMO)

MMP-14 protein is an endopeptidase that degrades collagen and activates progelatinase A. MMP-14 Protein, Human (His-SUMO) is the recombinant human-derived MMP-14 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of MMP-14 Protein, Human (His-SUMO) is 471 a.a., with molecular weight of ~69.9 KDa.

MMP-14 Protein serves as a critical endopeptidase, targeting various components of the extracellular matrix, notably collagen, and playing a pivotal role in pericellular collagenolysis during development, contributing to the modeling of both skeletal and extraskeletal connective tissues. Additionally, MMP-14 activates progelatinase A, acting as a key player in the intricate regulation of the extracellular matrix. Beyond its matrix-degrading functions, MMP-14 is implicated in actin cytoskeleton reorganization by cleaving PTK7, highlighting its involvement in cellular processes beyond matrix remodeling. Furthermore, MMP-14 acts as a positive regulator of cell growth and migration through the activation of MMP15 and plays a crucial role in the formation of fibrovascular tissues in conjunction with pro-MMP2. Notably, MMP-14 cleaves ADGRB1, releasing vasculostatin-40, which exerts anti-angiogenic effects by inhibiting angiogenesis. This multifaceted functionality underscores MMP-14's significance in orchestrating diverse cellular processes and its potential as a therapeutic target in various physiological contexts.

Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is 3373.72 pmol/min/µg, as measured under the described conditions.

Human

E. coli

N-6*His;N-SUMO

P50281 (Y112-V582)

4323  [NCBI]

YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Approximately 69.9 kDa.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.