1. Recombinant Proteins
  2. Others
  3. nAChRα5 Protein, Human (HEK293, His)

nAChRα5 Protein, Human (HEK293, His)

Cat. No.: HY-P70340
COA Handling Instructions

The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of nAChRα5 Protein, Human (HEK293, His) is 232 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $140 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of nAChRα5 Protein, Human (HEK293, His) is 232 a.a., with molecular weight of 35-40 kDa.

Background

Upon acetylcholine binding, nAChRα5 Protein initiates a substantial conformational change that influences all subunits, ultimately resulting in the opening of an ion-conducting channel across the plasma membrane. The neuronal AChR is evidently comprised of two distinct types of subunits: the alpha subunits and the non-alpha β subunits. Notably, nAChRα5 Protein engages in interactions with LYPD6, as documented in studies. This molecular interaction sheds light on the intricate regulatory mechanisms underlying the functionality of neuronal acetylcholine receptors, emphasizing the dynamic nature of their conformational changes and their significance in ion channel activation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P30532/NP_000736.2 (R23-T254)

Gene ID
Molecular Construction
N-term
nAChRα5 (R23-T254)
Accession # P30532
6*His
C-term
Synonyms
rHuNeuronal acetylcholine receptor subunit alpha-5/NACHRA5, His; Neuronal Acetylcholine Receptor Subunit Alpha-5; CHRNA5; NACHRA5
AA Sequence

RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYT

Molecular Weight

35-40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

nAChRα5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
nAChRα5 Protein, Human (HEK293, His)
Cat. No.:
HY-P70340
Quantity:
MCE Japan Authorized Agent: