Noggin Protein, Human (205a.a, HEK293)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Human (205a.a, HEK293) is the recombinant human-derived Noggin protein, expressed by HEK293 , with tag free. The total length of Noggin Protein, Human (205a.a, HEK293) is 205 a.a., with molecular weight of ~29.7 kDa.

Noggin protein emerges as a crucial inhibitor in the intricate realm of bone morphogenetic proteins (BMP) signaling, playing indispensable roles in neural tube and somite growth, as well as contributing to the intricate processes of cartilage morphogenesis and joint formation. Operating through its homodimeric structure, Noggin establishes a significant interaction with GDF5, and likely GDF6, exerting its inhibitory influence on chondrocyte differentiation. This molecular interplay underscores Noggin's pivotal position in regulating key aspects of embryonic development, emphasizing its nuanced involvement in sculpting the intricate patterns and structures critical for proper growth and morphogenesis.

Human

HEK293

Tag Free

Q13253/NP_005441.1 (Q28-C232)

9241  [NCBI]

MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 29.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.