1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF superfamily
  4. Neuregulins
  5. NRG1-beta 1 Protein, Human (65a.a)

NRG1-beta 1 Protein, Human (65a.a)

Cat. No.: HY-P71171
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $120 Ask For Quote & Lead Time
50 μg $360 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

NRG1-beta 1 Protein, Human (65a.a) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q02297-6 (S177-E241)

Gene ID

3084

Synonyms
Pro-neuregulin-1; Neuregulin-1 beta 1; NRG1-beta 1; HRG1-beta 1; EGF; NRG1; GGF; HGL; HRGA; NDF; SMDF;
AA Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Weight

Approximately 7.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRG1-beta 1 Protein, Human (65a.a)
Cat. No.:
HY-P71171
Quantity:
MCE Japan Authorized Agent: