1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. OSM Protein, Rat

OSM Protein, Rat

Cat. No.: HY-P7105
Handling Instructions

OSM Protein, Rat is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 Get quote
100 μg $1050 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

OSM Protein, Rat Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q65Z15 (K26-R239)

Gene ID

289747

Synonyms
rRtOSM; OSM
AA Sequence

MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR

Molecular Weight

Approximately 24.5 kDa

Biological Activity
The ED50 is <10 ng/mL as measured by Rat Embryo Brain cells, corresponding to a specific activity of >1 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism. The full-length Oncostatin M proteins contain between 239 and 263 amino acids which fold into a long-chain four helix-bundle protein with an up-up-down-down topology representative of all other IL-6 family cytokines. Human Oncostatin-M can bind to either the type I receptor complex consisting of gp130 and the LIFR (gp130/LIFRb) or the type II receptor complex consisting of gp130 and the OSMR (gp130/OSMRb). In the murine system Oncostatin-M has been shown to bind with high affinity only to the type II gp130/OSMRb complex[1][2]. Oncostatin-M binds to specific receptor complexes, then activates two major signaling pathways: Janus Kinase-Signal Transducers and Activators of Transcription (JAK-STAT) and Mitogen-Activated Protein Kinase (MAPK), to regulate downstream events[3].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OSM Protein, Rat
Cat. No.:
HY-P7105
Quantity:
MCE Japan Authorized Agent: