1. Recombinant Proteins
  2. PDGFAA, Human (His)

PDGFAA, Human (His)

Cat. No.: HY-P70825
Handling Instructions

PDGFAA, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $170 In-stock
Estimated Time of Arrival: December 31
50 μg $510 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
PDGFAA; PDGF-AA
Species

Human

Source

E. coli

Accession

P04085 (S87-T211)

Gene ID

5154

Molecular Weight

Approximately 16.0 kDa

AA Sequence

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Platelet-Derived Growth Factor-AA is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor[1]. PDGF-AA may play a crucial role in the ability of ASCs and EPCs to enhance wound healing, especially in animal models with wound-healing deficits[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGFAA, Human (His)
Cat. No.:
HY-P70825
Quantity:
MCE Japan Authorized Agent: