1. Recombinant Proteins
  2. Others
  3. PENK Protein, Human (HEK293, His)

PENK Protein, Human (HEK293, His)

Cat. No.: HY-P71057
COA Handling Instructions

PENK, a neuropeptide, competes with and mimics opiate drugs, impacting pain perception and stress responses. Within the neural signaling network, PENK significantly influences opiate effects, contributing to the regulation of pain perception and stress responses. PENK Protein, Human (HEK293, His) is the recombinant human-derived PENK protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PENK Protein, Human (HEK293, His) is 243 a.a., with molecular weight of 34-38 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $161 In-stock
50 μg $450 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PENK, a neuropeptide, competes with and mimics opiate drugs, impacting pain perception and stress responses. Within the neural signaling network, PENK significantly influences opiate effects, contributing to the regulation of pain perception and stress responses. PENK Protein, Human (HEK293, His) is the recombinant human-derived PENK protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PENK Protein, Human (HEK293, His) is 243 a.a., with molecular weight of 34-38 kDa.

Background

PENK, a neuropeptide, functions as a competitor and mimicker of opiate drugs, influencing various physiological processes such as pain perception and responses to stress. Operating within the intricate neural signaling network, PENK plays a significant role in modulating the effects of opiates, contributing to the regulation of pain perception and stress responses in the body.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01210 (E25-F267)

Gene ID
Synonyms
Proenkephalin-A; Synenkephalin; Met-Enkephalin; Leu-Enkephalin; PENK
AA Sequence

ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF

Molecular Weight

34-38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PENK Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PENK Protein, Human (HEK293, His)
Cat. No.:
HY-P71057
Quantity:
MCE Japan Authorized Agent: