1. Recombinant Proteins
  2. Recombinant Human Bone Morphogenetic Protein 4

Recombinant Human Bone Morphogenetic Protein 4

Cat. No.: HY-P7007
Handling Instructions

Recombinant Human Bone Morphogenetic Protein 4 is a member of the BMP-family, and a part of the transforming growth factor (TGF-β) superfamily, effectvie in mesenchyme formation and the development of multiple organs.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE Recombinant Human Bone Morphogenetic Protein 4

    Recombinant Human Bone Morphogenetic Protein 4 purchased from MCE. Usage Cited in: Oxid Med Cell Longev. 2020 Jun 8;2020:4175613.

    Western blot and grey analysis of CYP11a1, CYP19a1, BCL2, CALR, CHOP, caspase3, caspase12, PERK, and GRP78. qRT-PCR analyzed ATF4, caspase3, and GRP78 mRNAs. The relieving function of BMP4 on ER stress is diminished after blockade of BMP receptor I (BMPRI) with DM-3189.
    • Technical Parameters

    • Properties

    • Documentation

    Synonyms
    rHuBMP-4; BMP-2B
    Species

    Human

    Source

    E. coli

    Accession

    P12644

    Gene ID

    652

    Molecular Weight

    Approximately 13.3 kDa

    AA Sequence

    MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

    Appearance

    Lyophilized powder.

    Formulation

    Lyophilized after extensive dialysis against solution in 50 mM Na2CO3, 5 mM DTT, pH 11.0.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    Reconstitute the lyophilized recombinant Human Bone Morphogenetic Protein 4 (rHuBMP-4) to 0.1-1.0 mg/mL using sterile distilled water or aqueous buffer containing 0.1% BSA.

    Storage & Stability

    Lyophilized recombinant Human Bone Morphogenetic Protein 4 (rHuBMP-4) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Background

    Bone morphogenetic protein-4 (BMP-4) is a member of the BMP-family, a group of growth factors, initially discovered for their ability to initiate bone formation when transplanted to ectopic sites. Bone morphogenetic protein-4 is part of the transforming growth factor (TGF-β) superfamily and is widely expressed from early embryogenesis through adulthood. Bone morphogenetic protein-4 also plays a key role in mesenchyme formation and the development of multiple organs. In addition, BMP-4 also functions as a differentiation factor to hematopoietic and nerve cells and promotes epidermal commitment. Mature BMP-4 is a homodimeric glycoprotein with a cystine knot[1].

    Documentation
    References
    • Molarity Calculator

    • Dilution Calculator

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Salutation

    Applicant Name *

     

    Email address *

    Phone number *

     

    Organization name *

    Department *

     

    Requested quantity *

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Recombinant Human Bone Morphogenetic Protein 4
    Cat. No.:
    HY-P7007
    Quantity:
    MCE Japan Authorized Agent: