1. Recombinant Proteins
  2. MCP-2/CCL8, Human (HEK293, His)

MCP-2/CCL8, Human (HEK293, His)

Cat. No.: HY-P7770
Handling Instructions

Recombinant Human C-C Motif Chemokine 8, His (HEK293-expressed) is a member of the monocyte-chemoattractant protein family, and functions in a wide variety of inflammatory cells as a chemotactic factor.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $105 In-stock
Estimated Time of Arrival: December 31
50 μg $314 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCCL8, His; C-C Motif Chemokine 8; HC14; Monocyte Chemoattractant Protein 2; Monocyte Chemotactic Protein 2; MCP-2; Small-Inducible Cytokine A8; CCL8; MCP2; SCYA10; SCYA8
Species

Human

Source

HEK 293

Accession

P80075 (Q24-P99)

Gene ID

6355

Molecular Weight

Approximately 13 kDa

AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKPHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB,150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Chemokine (C-C motif) ligand 8 (CCL8), also known as MCP-2, was first identified in human osteosarcoma cells, and functions in a wide variety of inflammatory cells as a chemotactic factor. CCL8 contributes to the dissemination of breast cancer, and promotes the migration and invasion of esophageal squamous cell carcinoma. On the other hand, it has also been reported that CCL8 inhibits growth of cervical carcinoma tumors and exhibits an antitumor metastatic effect in melanoma. CCL8 dramatically activates ERK1/2 phosphorylation in glioblastoma cells, and blocking TAM-secreted CCL8 by neutralized antibody significantly decreases invasion of glioma cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-2/CCL8, Human (HEK293, His)
Cat. No.:
HY-P7770
Quantity:
MCE Japan Authorized Agent: