1. Recombinant Proteins
  2. Recombinant Human Carbonic Anhydrase 4, His

Recombinant Human Carbonic Anhydrase 4, His

Cat. No.: HY-P7720
Handling Instructions

Recombinant Mouse Carbonic Anhydrase 4, His a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCarbonic Anhydrase 4, His; Carbonic Anhydrase 4; Carbonate Dehydratase IV; Carbonic Anhydrase IV; CA4
Species

Human

Source

E. coli

Accession

P22748

Gene ID

762

Molecular Weight

Approximately 30.0 kDa

AA Sequence

AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Recombinant Human Carbonic Anhydrase 4, His (rHuCarbonic Anhydrase 4, His) is stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

The human carbonic anhydrase IV (CA4) gene, located on chromosome 17q22, was the first identified membrane-bound isozyme in the 16-member carbonic anhydrase (CA) gene family and contains 1,170 base pairs. The CA4 enzyme is involved in the formation of gastric acid and participates in acid-base homeostasis. CA4 is expressed in normal human stomach tissues. CA4 may serve an important role in gastric cancer (GC) tumorigenesis by inhibiting cellular proliferation via regulating the expression of cell cycle‑associated proteins. CA4 may serve as a diagnostic biomarker and a potential therapeutic target in GC[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Carbonic Anhydrase 4, His
Cat. No.:
HY-P7720
Quantity:
MCE Japan Authorized Agent: