1. Recombinant Proteins
  2. Recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed)

Recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed)

Cat. No.: HY-P70092
Handling Instructions

Recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed) is a negative regulator of collagen matrix deposition. CTHRC1, a secreted 28-kDa protein, is a glycosylated protein with a signal sequence.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $165 In-stock
Estimated Time of Arrival: December 31
50 μg $495 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCollagen triple helix repeat-containing protein 1/CTHRC1, His; Collagen triple helix repeat-containing protein 1; Protein NMTC1; CTHRC1
Species

Human

Source

HEK 293

Accession

Q96CG8

Gene ID

115908

Molecular Weight

25-30 kDa

AA Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Purity

Greater than 95% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed) (rHuCollagen triple helix repeat-containing protein 1/CTHRC1, His) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed) (rHuCollagen triple helix repeat-containing protein 1/CTHRC1, His) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CTHRC1 is a secreted 28-kDa protein that is glycosylated and highly conserved from lower chordates to mammals. A short collagen motif with 12 Gly-X-Y repeats appears to be responsible for trimerization of the protein and this renders the molecule susceptible to cleavage by collagenase. Cthrc1 mRNA expression levels are increased in response to transforming growth factor-beta and bone morphogenetic protein-4. Although CTHRC1 is associated with the extracellular matrix and contains a short collagen-like motif, its transient expression in the vessel wall argues against a function as a structural protein unlike other members of the collagen family. A series of articles suggested that overexpression of CTHRC1 promotes tumor progression through various signaling pathways via angiogenesis, the infiltration of tumor-associated macrophages and epithelial-mesenchymal transition[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Collagen triple helix repeat-containing protein 1/CTHRC1, His (HEK293-expressed)
Cat. No.:
HY-P70092
Quantity:
MCE Japan Authorized Agent: