1. Recombinant Proteins
  2. Recombinant Human Dynein light chain 1, cytoplasmic/DYNLL1, His

Recombinant Human Dynein light chain 1, cytoplasmic/DYNLL1, His

Cat. No.: HY-P70048
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $495 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuDynein light chain 1, cytoplasmic/DYNLL1, His; Dynein Light Chain 1 Cytoplasmic; 8 kDa Dynein Light Chain; DLC8; Dynein Light Chain LC8-Type 1; Protein Inhibitor of Neuronal Nitric Oxide Synthase; PIN; DYNLL1; DLC1; DNCL1; DNCLC1; HDLC1
Species

Human

Source

E. coli

Accession

P63167

Gene ID

8655

Molecular Weight

Approximately 14.0 kDa

AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Purity

Greater than 95% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Dynein light chain 1, cytoplasmic/DYNLL1, His (rHuDynein light chain 1, cytoplasmic/DYNLL1, His) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Dynein light chain 1, cytoplasmic/DYNLL1, His (rHuDynein light chain 1, cytoplasmic/DYNLL1, His) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Dynein light chain 1, cytoplasmic/DYNLL1, His
Cat. No.:
HY-P70048
Quantity:
MCE Japan Authorized Agent: