1. Recombinant Proteins
  2. Recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed)

Recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed)

Cat. No.: HY-P70237
Handling Instructions

Recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed) is a recombinant Human Follicle-stimulating hormone (FSH) produced in HEK293 cells, with Flag-His tag. FSH is a glycoprotein polypeptide hormone[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $170 In-stock
Estimated Time of Arrival: December 31
50 μg $510 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuFollicle-stimulating hormone/FSH, Flag-His; Follicle-stimulating hormone; FSH; FSH alpha/beta
Species

Human

Source

HEK 293

Accession

P01215&P01225

Gene ID

1081&2488

Molecular Weight

20-30 kDa

AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed) (rHuFollicle-stimulating hormone/FSH, Flag-His) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed) (rHuFollicle-stimulating hormone/FSH, Flag-His) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Follicle-stimulating hormone (FSH) is a hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus. FSH is a glycoprotein dimer with alpha and beta subunits. FSH plays a role in sexual development and reproduction in both males and females[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Follicle-stimulating hormone/FSH, Flag-His (HEK293-expressed)
Cat. No.:
HY-P70237
Quantity:
MCE Japan Authorized Agent: