1. Recombinant Proteins
  2. Recombinant Human Insulin-like Growth factor-2

Recombinant Human Insulin-like Growth factor-2

Cat. No.: HY-P7019
Handling Instructions

Recombinant Human Insulin-like Growth factor-2 is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $80 In-stock
Estimated Time of Arrival: December 31
50 μg $170 In-stock
Estimated Time of Arrival: December 31
100 μg $270 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIGF-2; Somatamedin A; IGF-II
Species

Human

Source

E. coli

Accession

P01344

Gene ID

3481

Molecular Weight

Approximately 7.6 kDa

AA Sequence

MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Biological Activity
The ED50 is <20 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >5 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 25 mM Tris, pH 8.0.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Insulin-like Growth factor-2 (rHuIGF-2) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Insulin-like Growth factor-2 (rHuIGF-2) is stored at -20°C. After reconstitution, it is stable at 4°C for 2 weeks or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Insulin-like growth factor (IGF) modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Human Insulin-like Growth factor-2 (IGF-II) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Insulin-like Growth factor-2
Cat. No.:
HY-P7019
Quantity:
MCE Japan Authorized Agent: