1. Recombinant Proteins
  2. Recombinant Human Interleukin-1 Receptor Antagonist Protein

Recombinant Human Interleukin-1 Receptor Antagonist Protein

Cat. No.: HY-P7029
Handling Instructions

Recombinant Human Interleukin-1 Receptor Antagonist Protein is a member of the IL-1 family that binds to IL-1 receptors.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $80 In-stock
Estimated Time of Arrival: December 31
50 μg $160 In-stock
Estimated Time of Arrival: December 31
100 μg $220 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE Recombinant Human Interleukin-1 Receptor Antagonist Protein

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-1RA; IL-1RN; IRAP
Species

Human

Source

E. coli

Accession

P18510

Gene ID

3557

Molecular Weight

Approximately 17,258 Da

AA Sequence

MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Biological Activity
The ED50 is <0.5 ng/mL as measured by D10S cells, corresponding to a specific activity of 2.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris-HCl, pH 7.5, 200 mM NaCl buffer.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Interleukin-1 Receptor Antagonist Protein (rHuIL-1RA) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Interleukin-1 Receptor Antagonist Protein (rHuIL-1RA) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome[1]. IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Interleukin-1 Receptor Antagonist Protein
Cat. No.:
HY-P7029
Quantity:
MCE Japan Authorized Agent: